PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000897.1_g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family HD-ZIP
Protein Properties Length: 294aa    MW: 32602.6 Da    PI: 8.0548
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000897.1_g00035.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18127181256
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Itr_sc000897.1_g00035.1 127 RKKLRLNKDQSAILEETFKEHNTLNPKQKLGLAKRLGLRPRQVEVWFQNRRARTK 181
                              788899***********************************************98 PP

2HD-ZIP_I/II125.91.8e-40127216191
              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 
                              +kk+rl+k+q+++LEe+F+e+++L+p++K  la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke ++
  Itr_sc000897.1_g00035.1 127 RKKLRLNKDQSAILEETFKEHNTLNPKQKLGLAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEVLKRCCENLTEENRRLHKEIQQ 212
                              69************************************************************************************ PP

              HD-ZIP_I/II  87 Lreel 91 
                              Lr +l
  Itr_sc000897.1_g00035.1 213 LR-AL 216
                              *9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.7E-174108IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.07E-17120184IPR009057Homeodomain-like
PROSITE profilePS5007116.973123183IPR001356Homeobox domain
SMARTSM003893.7E-14125187IPR001356Homeobox domain
PfamPF000468.0E-16127181IPR001356Homeobox domain
CDDcd000861.11E-14127184No hitNo description
Gene3DG3DSA:1.10.10.603.2E-17133181IPR009057Homeodomain-like
PRINTSPR000315.4E-5154163IPR000047Helix-turn-helix motif
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PRINTSPR000315.4E-5163179IPR000047Helix-turn-helix motif
SMARTSM003401.8E-25183226IPR003106Leucine zipper, homeobox-associated
PfamPF021831.8E-11183217IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTLEYQDLGL SLKLGFSGES CGRASETPQN LNLSTSSSSS HSSPFHSSPC WADRNSDACG  60
RAEAAAFLKG IDVNRAPAAA AADGEEEAWV SSPNNSTVSS GSKRSEREDQ ETERACSDEE  120
DGGEASRKKL RLNKDQSAIL EETFKEHNTL NPKQKLGLAK RLGLRPRQVE VWFQNRRART  180
KLKQTEVDCE VLKRCCENLT EENRRLHKEI QQLRALKLSP HFYMQMPPPT TITMCPSCEC  240
VAVPPPASSP AIYSYGSLVT NRNGLTKALP LQHMGTCVDP HRRFDVTRPN TLKL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125131SRKKLRL
2175183RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-105PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054662e-86HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A067L7241e-103A0A067L724_JATCU; Uncharacterized protein
STRINGVIT_00s0299g00100.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-74homeobox protein 2